A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10330 |
Swiss-prot Accession number | Q6UC74 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Cervus elaphus (Red deer) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Cervidae; Cervinae; Cervus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 25794 |
References | 1 PubMed abstract 12742553 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | TPVCPNGAGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDGILSRAIEIEEENKRLLEGMEMIFGQVLPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q28235
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10728 |
Swiss-prot Accession number | P56437 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Cervus elaphus (Red deer) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Cervidae; Cervinae; Cervus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
Protein Length | 217 Amino acids |
Molecular weight | 24558 |
References | 1 PubMed abstract 9460647 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | FPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF |
Position of mature hormone in Pre-Hormone protein | 190 Residues from position (28-217) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |